General Information

  • ID:  hor000718
  • Uniprot ID:  Q8WRC7??45-53)
  • Protein name:  Cardioactive peptide
  • Gene name:  CCAP
  • Organism:  Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm)
  • Family:  NA
  • Source:  animal
  • Expression:  Abdominal perivisceral organ; major neurohemal release site. Expressed in 116 neurons in post-embryonic central nervous system. Nine pairs of cells are observed in the brain, 4.5 pairs in the subesophageal ganglion, three pairs in each thoracic ganglion (
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Manduca (genus), Sphingini (tribe), Sphinginae (subfamily), Sphingidae (family), Bombycoidea (superfamily), Obtectomera, Ditrysia, Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0045823 positive regulation of heart contraction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  PFCNAFTGC
  • Length:  9(45-53)
  • Propeptide:  MTVSRVCLLLLVALVYLDCCYAASIPRNFDPRLSEEIVMAPKKRPFCNAFTGCGRKRSQGPPGMPAQDLRTKQYLDEEALGSILDSESAIDELSRQILSEAKLWEAIQEASAEIARRKQKEAYIQ
  • Signal peptide:  MTVSRVCLLLLVALVYLDCCYA
  • Modification:  T9 Cysteine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Cardioregulatory neurohormone that increases heart beat rate during adult wing inflation; has no effect on beat amplitude. The effect of CCAP is both ino- and chronotropic
  • Mechanism:  NA
  • Cross BBB:  NO
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  45725
  • Structure ID:  1y49(PDB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    1y49.pdbhor000718_AF2.pdbhor000718_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 110198 Formula: C42H58N10O12S2
Absent amino acids: DEHIKLMQRSVWY Common amino acids: CF
pI: 5.84 Basic residues: 0
Polar residues: 5 Hydrophobic residues: 3
Hydrophobicity: 68.89 Boman Index: 206
Half-Life: >20 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: ? Aliphatic Index 11.11
Instability Index: 2085.56 Extinction Coefficient cystines: 125
Absorbance 280nm: 15.63

Literature

  • PubMed ID:  1426284
  • Title:  Primary Structure of a Cardioactive Neuropeptide From the Tobacco Hawkmoth, Manduca Sexta